Product Description
LL-37 exhibits potent antibacterial, antifungal, and antiviral properties, making it an important tool for studying innate immune responses and antimicrobial mechanisms.
Beyond direct antimicrobial activity, LL-37 modulates immune cell function, enhances chemotaxis, regulates cytokine production, and contributes to the resolution of inflammation.
LL-37 has been shown to accelerate epithelial cell migration, angiogenesis, and tissue repair, supporting research in regenerative medicine and skin biology.
The peptide can disrupt biofilms, a common challenge in chronic infections, enabling studies on infection prevention and therapeutic interventions.
LL-37 is non-toxic to mammalian cells at effective concentrations, making it suitable for in vitro and ex vivo research.
| Parameter | Description |
| CAS Number | 154947-66-7 |
| Product Name | LL-37 |
| Molecular Formula | C₁₇₄H₂₈₀N₅₀O₄₆ |
| Molecular Weight | 4493.23 g/mol |
| Amino Acid Sequence | [LL-37, 37 aa] |
| Appearance | White to off-white lyophilized powder |
| Storage | –20°C, protected from light and moisture |
| Specification | Option |
| Purity | ≥95% (HPLC) |
| Form | Lyophilized powder |
| Vial Sizes | 1 mg, 5 mg, 10 mg (custom sizes available) |
| Packaging | Sterile sealed vials, moisture-resistant, temperature-controlled |
| Shelf Life | 24 months under recommended storage conditions |
1. Antimicrobial Research: Studying LL-37’s activity against Gram-positive and Gram-negative bacteria, fungi, and viruses, including biofilm disruption.
2. Immunology & Inflammation Studies: Investigating chemotactic activity, cytokine modulation, and innate immune responses in cellular models.
3. Wound Healing & Regenerative Medicine: Used in models of epithelial migration, angiogenesis, and tissue repair to evaluate therapeutic potential.
4. Skin & Dermatology Research: LL-37 is widely used in studies on skin barrier function, infection prevention, and anti-inflammatory skin therapies.
5. Peptide Therapeutic Development: Serves as a template for designing synthetic antimicrobial peptides, immunomodulators, and regenerative compounds.
